PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13129s0364.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family MYB
Protein Properties Length: 522aa    MW: 58052.9 Da    PI: 5.8707
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13129s0364.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-163481148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W+  Ed++l d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Bostr.13129s0364.1.p 34 KGPWSSAEDDILFDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 81
                          79******************************************9986 PP

2Myb_DNA-binding53.65.2e-1787130146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
  Bostr.13129s0364.1.p  87 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 130
                           799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016935.3E-2781521IPR016310Transcription factor, GAMYB
PROSITE profilePS5129414.7982981IPR017930Myb domain
SuperFamilySSF466892.13E-2932128IPR009057Homeodomain-like
SMARTSM007171.7E-143383IPR001005SANT/Myb domain
PfamPF002497.4E-153481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-233588IPR009057Homeodomain-like
CDDcd001673.20E-113681No hitNo description
PROSITE profilePS5129426.31682136IPR017930Myb domain
SMARTSM007172.7E-1786134IPR001005SANT/Myb domain
PfamPF002491.0E-1587130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2589135IPR009057Homeodomain-like
CDDcd001671.34E-1289130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MSYTTTDSDH NESPAADDNG SDCRSRWEGN ALKKGPWSSA EDDILFDYVN KHGEGNWNAV  60
QKHTGLFRCG KSCRLRWANH LRPNLKKGAF SQEEEQLIVE LHAKMGNRWA RMAAHLPGRT  120
DNEIKNYWNT RIKRRQRAGL PLYPPEMHVE VLEWSQEYAK SRIMGEDRRH SDFLQLGSCE  180
SNVFFDNLNF VTSMVPGASD LVDMTAYKNL GIAASSPRYE NFLTPILPSS KRLWESELLY  240
PGCSSTIKQE FPSPEQFQNT SPQKISKTCS FSVPCDVDHP LYGNQHSPVM IPDSHTPTGG  300
IVPSSKPSYG AVKLELPSFQ YSETTFDQWK KSSSPPHSDL LDPFDAYIQS PPPPTGREES  360
DYFSNCDTGL LDMLLLEAKI RNNTTKNNLY KSCASTIPSA DLGEVTVSQT KSEEFDSSLK  420
SLVHSEISTQ QNADGIPLRQ RGKKQKPLLD ITRPDVMLAS SWLDHGLGIV KETGSMNDAL  480
AVLLGDDIGN DYMHTSVGAS SGVGSCSWSN MPPVCQMTEL P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-302313513127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287507.10.0hypothetical protein CARUB_v10000715mg
TrEMBLR0H6G30.0R0H6G3_9BRAS; Transcription factor
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33